Fat Loss Tips in Hindi: Jane
1 / 7

Fat Loss Tips in Hindi: Banaye Apne Aap Ko Physically Fit - PowerPoint PPT Presentation

  • Uploaded on

Yadi aap bhi apne sharir ki badhi bhui atirikt charbi se pareshan hai to yaha padhiye Fat Loss Tips in Hindi aur rakhe apne aap ko physically Fit. Aur adhik jane: http://hrelate.com/fat-loss-tips-in-hindi/

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about 'Fat Loss Tips in Hindi: Banaye Apne Aap Ko Physically Fit' - cshradhha20

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

Fat Loss Tips in Hindi: Jane CharbiGhataneKeAasanTarike


Aajkalharkoi slim body pane keliyebahutkuchkartehaijaise gym jana, vyayamkarnaaurkhanakamkarna. Lekinkyaaapjantehaikisirfkhanakamkarneaurvyayamkarne s evanajnkamnhihotahai, balkikhanakamkarne se vyaktiyo ka vajanaurbadhjatahai. Darahsal jab vyaktimotapakamkarnekeliyekhanakamkartahai to wopatla to ho jatahailekin jab vyakti bad maiapnipurani diet maiaatahai to aachanak se motapabadhnashuru ho jatahai.

Aajkalkegalataurteliyayukt khan-pan, din bharbaithkarkamkarnekiwajeh se sharir ka motapaaurbadhnelagtahai. Aesemaivyaktiyokoapneaaharokokamkarnekibajayyehjannajarurihaikiaesekoun se tips haijinsevajankokamkiyajasaktahai? Yehjannekeliyeaaiyeaajiss article maijane Fat Loss Tips in Hindi.

Jab bhivyaktibaharke junk food aurkhadyapadartho ka sevankartehai to inmemilahua fat sharirmaijamnelagtahaiaurdhire-dhirecharbikobadhanashurukardetahai. Issjamehuye fat aur toxins kosharir se baharnikalnekeliyekaiprakarke tips hotehaijaiseniyamitauruchit khan-pan, vyayam, yoga aadi. Inn sabhi tips kimadad se sharieke fat koaasani se kamkiyajasaktahai. To aaiyepadhe Fat Loss Tips.


Fat Loss Tips in Hindi: Inn Tariko Se KamKareSharir Ka Fat


  • PeyYuktPadart

  • Apnesharirkicharbikokamkarnekeliyesabsejarurihotahaipeyyuktpadarthjaisepani, nimbupani, green tea, loki ka juice aadi. To aaiyejane fat loss drinks

  • Sharirkicharbikokamkarnekeliyehamekhubpani pine kijarurathotihai. Panisharir se fat kokamkarne, apshishtpadarthokogalaneaur toxins kobaharnikalnemaimadadkartahai.

  • Rojanasubahkhali pet 1 glass nimbupaniaur 1 chammachshahadkomilakar pine se sharirmaijamahua fat kam hone lagtahai.

  • Canberrymaimujud vitamin C aur antioxidant gun sharir se fat kojalanemaimadadkartehai. Iskesevankeliyecanberryke juice mainimbu ka rasaursirkamilakarpinachahiye.

  • Rojanachaykijagah green tea pine se sharirkicharbikokamkiyajasaktahai. Ismemojudflavonoidssharirmaimojud toxins aur fat kojalanemaimadadkartahaisath hi yeh pet kijwalansheeltakobhikamkarnemaisahayakhotahai.


  • KhadyaPadarthKeSevan Se

  • Fat kokamkarnekeliyekahnekimatrakokamkarnekibajayhameaeseaahao ka sevankarnachahiyejoki fat kokamkarnemaisahayakhotehai. To aaiyejane fat loss foods.

  • Fiber vasakogalanemaimadadkartahaiisliyesharir se charbikokamkarnekeliye fiber yuktbhojan ka sevankarnachahiye.

  • Badammaimojud Polyunsaturated aur Monounsaturated fat sharirko overeating se bachanemaimadadkartahai. Iskesath hi ismemojud fiber lambesamaytakbhukkolagnenahidetahai.

  • Tamatarmaimojud 9-oxa-ODA namakyogikkhun se lipid aur fat kokamkarnemaisahayakhotahai. Isliyetamatar ka sevancharbikokamkarnemaimadadgarhotahai.

  • Kheeremaimojud 96% panisharir se fat kokamkarnemaisahayakhotahai.

  • Iskealava, ublihuisabjiya, ajvainaadi ka sevansharir se charbikokamkarnemaisahayakhotahai.

  • NiyamitDincharya

  • Sharir se charbikokamkarnekeliyeapnidincharyakoniymitrup se sahi banana jarurihotahai. Sahisamay par khana, nashta, dinner aursahiaaharbhi fat kokamkarnemaimadadkartehai.


  • Inn FaloKeSevan Se

  • Falhamarisehatkeliyebahut hi faydemandhotehai. Kuchaesefalbhihotehaijokicharbikokamkarnemaisahayakhotehai to aaoiyejane a Fat loss fruits.

  • Tarbuj ka sevankare. Ismemojud 91% pani, Vitamin B1, B6 aur C aurjaruri minerals jaise potassium aurmegneciumsharirke fat kokamkarnemaimadadkartehai.

  • Seb (aaple) maiucchmatramaimojud fiber, footstool, flavonoidsaur beta-carotene sharir se badhihuicharbikokamkarnemaisahayakhotehai. Iskesath hi isme pectin namaktatvbhihotahaijokivajankokamkarnemaimadadkartahai.

  • Anannasmai brome lane namak enzyme hotahaijoki pet ko slim or flat banana maimadadkartahai.

  • MasaloKeSevan Se

  • Masalomaidalchini ka prayogsharir se extra fat kokamkarnemaimadadkartahai. Iserojanasubah 1 glass panimai 1 chammachshahadkesath pine se sharir se fat kamkarnemaimadadmiltihai. Iskealavapudinekepatte, kali mirchbhifaydemandhotehai.



Rojanakisibhiprakarkikasratbhiswasthaur fit body keliyeacchahotahai. Issesharir ka raktsanchran, sahirehtahaiaurvasakokamkarnemaibhimadadmiltihai. Isliyerojana 30 minute kikasratjarurkare.


Parhejki bat ka matlabyehnahiki ham apnekhane pine maiparhejkar de balkihameapnejyadateliyayukt, fast food aurbaharkekhane se parhejkarnachahiye.


Vyayamhamaresharir se atiriktcharbikokamkarnekesath-sathswasthkeliyebhiacchahotahai. Isliyerojanavyayamkohameapniniyamitdincharyamaishamilkarnachahiye. Charbikokamkarnekeliyehamekoun-koun se vyayamkarnachahiyeiskeliyeyahapadhe Exercise for Weight Loss.

Yoga BhiHaiFaydemand

Yoga nakevalhamareswasthkobehtarbananemaimadadkartahaibalkivajanaursharirkibadhihuicharbikobhikamkarnemaisahayakhotahai.
