Merancang survei designing survey
This presentation is the property of its rightful owner.
Sponsored Links
1 / 39

MERANCANG SURVEI DESIGNING SURVEY PowerPoint PPT Presentation


  • 95 Views
  • Uploaded on
  • Presentation posted in: General

MERANCANG SURVEI DESIGNING SURVEY. Diunduh dari: …www.ruforum.org/.../ Surveys /Designing%20 S ... 25/8/2012. METODE SURVEI DALAM KAJIAN LINGKUNGAN DAN PEMBANGUNAN. Soil biota and effects of land use change Effectiveness of extension organisations Market chains for farm produced timber

Download Presentation

MERANCANG SURVEI DESIGNING SURVEY

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


Merancang survei designing survey

MERANCANG SURVEIDESIGNING SURVEY

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012


Metode survei dalam kajian lingkungan dan pembangunan

METODE SURVEI DALAM KAJIAN LINGKUNGAN DAN PEMBANGUNAN

  • Soil biota and effects of land use change

  • Effectiveness of extension organisations

  • Market chains for farm produced timber

  • Local knowledge of water management

  • Genetic variation in medicinal trees

  • Livelihood – environment interactions

  • Mechanisms for science influencing policy

  • Participatory assessment of NRM problems

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012


Metode survei dalam kajian lingkungan dan pembangunan1

METODE SURVEI DALAM KAJIAN LINGKUNGAN DAN PEMBANGUNAN

Investigating variations in quality of life between different localities

The quality of life at a national or global scale is measured by the Physical Quality of Life Index (PQLI), devised in the 1980s.

The PQLI is the average of three characteristics: Literacy, life expectancy and infant mortality. However, the term is often used in urban studies of towns or cities to represent a multiple index of different criteria that reflects residents' housing standards and the environmental conditions in which they live. Other indicators, such as traffic levels, complete the picture of a particular area.

The basic primary data for this investigation is obtained from surveys of land use plus housing condition and environmental quality at various sample sites in chosen areas. The number of locations should be a reflection of the location area (population density) and the amount of time required.

DIUNDUH DARI: http://www.rgs.org/OurWork/Schools/Fieldwork+and+local+learning/Planning+your+fieldtrip/Planning+tools/Quality+of+life.htm ….. 28/8/2012


Metode survei dalam kajian lingkungan dan pembangunan2

METODE SURVEI DALAM KAJIAN LINGKUNGAN DAN PEMBANGUNAN

There are additional techniques that can be used, as shown in below:

General landscape evaluation. Based on gut feelings, for example boring vs. stimulating, ugly versus attractive, crowded versus peaceful, threatening versus welcoming, drab versus colourful. A street quality survey (JPG) can be used

Scale of visual pollution. Scores from zero to three: no pollution - badly polluted. Criteria might include, obviousness of pollution, litter, smalls, state of buildings, impact on surrounding area

Index of burgaralibility. Based on penalty points. Absence of burglar alarm, security cameras, metal bars on windows, metal shutters, neighbourhood watch sticker etc

Graffiti assessment. Criteria include: size of words, size of pictures, style of writing, visible from, method of writing/inscription, for example pen, paint, etc

Physical condition of buildings/index of decay. Range of options; none, little, some, much. Criteria: deterioration of walls, peeling paint, slipped tiles, broken glass, broken gutters, etc

Shopping survey. Looks at shopping quality and street appearance. Quality of shops: type, other land use, quality of goods, number of vacant units, etc. Street appearance: safety for pedestrians, crowdedness, street cleanliness, etc

DIUNDUH DARI: http://www.rgs.org/OurWork/Schools/Fieldwork+and+local+learning/Planning+your+fieldtrip/Planning+tools/Quality+of+life.htm ….. 28/8/2012


Principles and practice

PRINCIPLES AND PRACTICE

  • Principles are very widely applicable

    • you better know what they are!

  • Application depends on possibilities and constraints of the context

    • know your situation well

    • be familiar with methods used by others

    • refer to guides and methods sections of papers

  • BUT…

    • traditions and common practice can be inefficient or flawed

    • some of the most innovative and informative research comes from transfer of methods between disciplines

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012


Principles and practice1

PRINCIPLES AND PRACTICE

An analysis of health levels and various indicators of urban environments for Healthy Cities projects

T. Takano, K. Nakamura.

J. Epidemiol Community Health 2001;55:263-270 doi:10.1136/jech.55.4.263

Interrelation between the health determinants and the health status. “Health Status” is represented by the health index. “Healthcare resources”, “Preventive activities”, “Environmental quality”, “Housing”, “Urban clutter”, “Education”, “Employment”, “Income”, “Local economy” individually represent health-determinant factors. Fine thread arrows indicate pairs of health determinant indices with statistically significant correlation with Pearson correlation coefficients. Thick thread arrows show relation between health determinant indices and the index of health with Pearson correlation coefficients. (http://jech.bmj.com/content/55/4/263.full)


Tujuan

Tujuan

  • It all starts here!

  • Infinite variety, but often either:

    • current state (and change over time)

    • patterns, associations, differences…

  • But they need to be very clear.

  • Expect to iterate between objectives and study details

MetodeSurvei

Seringkalikitadihadapkanpadasuatukondisiuntukmenerimatugassurveikesuatutempatsesegeramungkin. Ketikatibadilokasi yang munculadalahkebingungankarenataktahuapa yang harusdiperbuat. Hal initidaksajaterjadipadamahasiswa.

Para penelitikadangkalabelumdapatmemilihmetodesurvei yang tepat.  Beberapapertanyaan yang haruskitajawabdarisebuahsurvei, yaitu: (1) Tentukantujuansurvei; (2) Pahamikondisi budget danwaktu yang dimiliki.

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012


Tujuan1

Tujuan

PengamatanKomunitas

Pemilihanfokuspada multi species atau single species dapatdijadikanpatokanpemilihanmetodenya. Mengapadidasarkanpada multi atauspesiestunggal? Pengamatan yang dilakukanpadabanyakburungmembutuhkankonsentrasi yang berbedadenganpengamatanhanyapadasatujenissaja. Tujuanmengamatisuatukomunitasadalah ‘menangkap’ segalajenis yang adadisuatulokasisehinggatergambarkekayaanjenis, tingkatdominansi (kemerataan), sertakomposisijenisburunglokasitersebut.

Diunduhdari: http://burung-nusantara.org/article/pilih-pilih-metode-survei/ ….. 29/8/2012


Two examples

Two examples

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012

  • Increased elephant damage reported in some villages. Are elephants moving along usual migration routes?

  • Is striga infestation worse when fields are suffering from soil erosion?

Soil erosion and agricultural sustainability

David R. Montgomery

PNAS August 14, 2007 vol. 104 no. 33 13268-13272

Data drawn from a global compilation of studies quantitatively confirm the long-articulated contention that erosion rates from conventionally plowed agricultural fields average 1–2 orders of magnitude greater than rates of soil production, erosion under native vegetation, and long-term geological erosion.

The general equivalence of the latter indicates that, considered globally, hillslope soil production and erosion evolve to balance geologic and climate forcing, whereas conventional plow-based agriculture increases erosion rates enough to prove unsustainable.

In contrast to how net soil erosion rates in conventionally plowed fields (≈1 mm/yr) can erode through a typical hillslope soil profile over time scales comparable to the longevity of major civilizations, no-till agriculture produces erosion rates much closer to soil production rates and therefore could provide a foundation for sustainable agriculture.

Diunduh dari: http://www.pnas.org/content/104/33/13268.abstract ….. 29/8/2012


Unit penelitian

UNIT PENELITIAN

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012

  • The items being studied

  • May be several

    • person, household, village

    • tree, field, watershed

    • gene, individual, family, population

    • farmer, extension officer, project, organisation

COSTA, Adriana Monteiro da et al.

DETAILED SOIL SURVEY OF THE HYDROGRAPHIC SMALL WATERSHED OF TERRA DURA (RS) FORESTRY GARDEN AND CONSIDERATIONS ABOUT MAPPING SCALES.

Ciênc. agrotec. [online]. 2009, vol.33, n.5, pp. 1272-1279. ISSN 1413-7054. 

The adequate utilization of information gathered from soil survey furnishes subsides for planning projects on diverse areas of activity, being agricultural or non-agricultural. However, it is being observed an increase of soil maps of hydrographic small watersheds and counties developed from small-scale maps without fieldwork.

This practice is not recommended since it can lead to wrong interpretations. So, this work had the objective to perform the detailed soil survey of a hydrographic small watershed situated in Rio Grande do Sul State and to compare the information obtained from the detailed soil survey (1:10,000 scale) to those from the amplified maps of reconnaissance soil survey of that state, (1:750,000 scale) and of the exploratory soil survey (1:1,000,000 scale).

The soil mapping units were quantified in terms of geographical expression area and percentage of total area.

The detailed soil survey identified 12 soil mapping units in the small watershed, while the amplified soil maps identified only one. In about 40% of the small watershed area, important attributes of forestry suitability for eucalyptus cultivation could not be adequately evaluated from amplified small-scale maps.

Diunduh dari: ….. 29/8/2012


Problematik

Problematik

  • Don’t confuse: unit(s) which are determined by objective and those you measure

    • may need to move information to new levels

  • ‘Ecological fallacy’ – trying to make inferences about individuals from measurements on groups

  • The opposite also fails!

  • ‘Modifiable areal unit problem’ : the relationship between X and Y depends on the scale at which they are measured.

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012


Problematik1

Problematik

Ecological fallacy :

Inferences about the nature of specific individuals are based solely upon aggregate statistics collected for the group to which those individuals belong.

The Ecological Fallacy is a situation that can occur when a researcher or analyst makes an inference about an individual based on aggregate data for a group. For example, a researcher might examine the aggregate data on income for a neighbourhood of a city, and discoverer that the average household income for the residents of that area is $30,000.

To state that the average income for residents of that area is $30,000 is true and accurate. No problem there. The ecological fallacy can occur when the researcher then states, based on this data, that people living in the area earn about $30,000. This may not be true at all, and may be an ecological fallacy.

Close examination of the neighbourhood might discover that the neighbourhood is actually composed of two housing estates, one of a lower socio-economic group of residents, and one of a higher socio-economic group. The poorer part of town residents earn on average $10,000 while the more affluent citizens can average $50,000. When the researcher stating that individuals who live in the area earn $30,000 (the mean rate) this did not account for the fact that the average in this example is constructed of two disparate groups, and it is likely that not one person earns $30,000.

Assumptions made about individuals based on aggregate data are vulnerable to the ecological fallacy.

This does not mean that identifying associations between aggregate figures is necessarily defective, and it doesn't necessarily mean that any inferences drawn about associations between the characteristics of an aggregate population and the characteristics of sub-units within the population are absolutely wrong either. What it does say is that the process of aggregating or disaggregating data may conceal the variations that are not visible at the larger aggregate level, and researchers, analysts and crime mappers should be careful.

Diunduhdari: http://www.jratcliffe.net/research/ecolfallacy.htm … 31/8/2012


Populasi penelitian

POPULASI PENELITIAN

  • The complete set of units you wish to study

  • Determined by the domain of the study – the extent of the problem you want the information to apply to

  • Common problem

    • poorly defined population

    • not stated but implied by sampling

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012


Populasi penelitian1

POPULASI PENELITIAN

POPULASI PENELITIAN

Secarasingkat “populasi” adalah :

Sekumpulanunsuratauelemen yang menjadiobyekpenelitiandanelemenpopulasiitumerupakanstuananalisis;

Sekolompokobyek, baikmanusia, gejala, nilaites, bendaatauperistiwa;

Semuaindividuuntuksiapakenyataan-kenyataan yang diperolehdarisampelituhendakdigeneralisasikan ;

Jumlahkeseluruhan unit analisis yang ciri-cirinyaakandiduga.

Dari beberapapengertiandiatasdapatdisimpulkanbahwa :

“Populasi” adalahkeseluruhanobyekpenelitian yang dapatterdiridarimanusia, benda, hewan, tumbuhan, gejala, nilaites, atauperistiwa; sebagaisumber data yang memilikikarakteristiktertentudalamsuatupenelitian. (Sumber: http://id.shvoong.com/social-sciences/education/2165683-populasi-penelitian/#ixzz25KrIzLWE).

PopulasiSurveiPopulasi Target merupakanpopulasi yang telahditentukansesuaidenganmasalahpenelitian.Populasisurveimerupakanpopulasi yang terliputdalampenelitian yang dilakukan.Padadasarnya, dalamkeadaan ideal, populasi target hampirsamadenganpopulasisurvei, tetapidalampraktekpopulasi target berbedadengansurvei. (Sumber: http://id.shvoong.com/social-sciences/education/2165683-populasi-penelitian/#ixzz25KrpvvII)

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012


Sampling

Sampling

Ada empat hal penting dalam kaitannya dengan sampling:

  • Simple random sampling

  • Stratification

  • Hierarchical (multistage) sampling

  • Systematic sampling

  • Note: good practical sampling schemes will probably use a combination of these

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012


Sampling1

Sampling

SAMPEL

Sampeladalahsebagiandaripopulasi, artinyatidakakanadasampeljikatidakadapopulasi. Populasimeruipakankeseluruhanelemenatauunsur yang akanditeliti. Penelitian yang dilakukanatasseluruhelemendinamakansensus. Idealnya, agar hasilpenelitiannyalebihdapatdipercaya, seorangpenelitiharusmelakukansensus. Namunkarenasesuatuhal, penelitidapatmenelitisebagiandarikeseluruhanelemenatauunsurtadi.

Syaratsampel yang baik

Secaraumum, sampel yang baikadalahsampel yang dapatmewakilisebanyakmungkinkarakteristikpopulasi. Dalambahasapengukuran, artinyasampelharus valid, yaitubisamengukursesuatu yang seharusnyadiukur. Kalau yang ingindiukuradalahmasyarakatSundasedangkan yang dijadikansampeladalahhanyaorangBantensaja, makasampeltersebuttidak valid, karenatidakmengukursesuatu yang seharusnyadiukur (orangSunda). Sampel yang valid ditentukanolehduapertimbangan, yaituAkurasidanPresisi.

Akurasiatauketepatan , yaitutingkatketidakadaan “bias” (kekeliruan) dalam sample. Dengankata lain makinsedikittingkatkekeliruan yang adadalamsampel, makinakuratsampeltersebut. Tolokukuradanya “bias” ataukekeliruanadalahpopulasi.

Presisimengacupadapersoalansedekatmanaestimasikitadengankarakteristikpopulasi. Presisidiukurolehsimpanganbaku (standard error). Semakinkecilperbedaandiantarasimpanganbaku yang diperolehdarisampel (S) dengansimpanganbakudaripopulasi (s), semakintinggi pula tingkatpresisinya.

Ukuransampel

Ukuransampelataujumlahsampel yang diambilmenjadipersoalan yang pentingmanakalajenispenelitian yang akandilakukanadalahpenelitian yang menggunakananalisiskuantitatif. Padapenelitian yang menggunakananalisiskualitatif, ukuransampelbukanmenjadinomorsatu, karena yang dipentingkanalahkekayaaninformasi. Walaujumlahnyasedikittetapijikakayaakaninformasi, makasampelnyalebihbermanfaat.

Diunduhdari: home.unpar.ac.id/~hasan/SAMPLING 2/9/2012


Common problems

Common problems

  • No explicit sampling scheme

    • bias

    • subjective results

  • Weak use of stratification

    • can greatly improve studies to identify relationships

MenentukanukuransampelmenurutSlovin

Menggunakanrumus :

n = ukuransampel

N = ukuranpopulasi

e = persenkelonggaranketidaktelitiankarenakesalahanpengambilansampel yang masihdapatditolerirataudiinginkanmisalnya 2%.

Diunduhdari: af-file.googlecode.com/files/populasi-dan-sampel-.pptx….. 2/9/2012

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012


Stratifikasi untuk estimasi hubungan

StratifikasiuntukestimasiHubungan

  • Example: survey to look at ‘market integration’ and relation with poverty.

  • Two variables associated with market integration (mi); distance from main road (d), length of time settled (t)

mi

d

t

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012


Merancang survei designing survey

Tipe-tipeMetode Sampling

Samples

Probability Samples

Non-Probability Samples

Simple

Random

Quota

Stratified

Judgement

Convinience

Cluster

Systematic

Snow ball

Area

Purposive


Random sampling

Random sampling

  • Most observations clustered around the mean d, hence poor estimate of response

SIMPLE RANDOM SAMPLING

Cara Undian

  • Dengancaramemberikannomor-nomorpadaseluruhanggotapopulasi, lalusecaraacakdipilihnomor-nomorsesuaidgnbanyaknyajumlahsampel yang dibutuhkan.

  • Adaduarancangancaraundian :

    • Pengambilansampeltanpapengembalian, yang berartisampel yang pernahterpilihtidakakandipilihlagi. Akanmenghasilkannilaiprobabilitas yang tidakkonstan

    • Pengambilansampeldenganpengembalian, yang berartisampel yang pernahterpilihadakemungkinanterpilihlagi. Megnghasilkannilaiprobabilitas yang konstan

Cara Tabelbilangan random

  • Menggunakantabelbilangan random (acak), yaitusuatutabel yang terdiridaribilangan-bilangan yang tidakberurutan.

  • Secaraprinsip, pemakaiannyaadalahdenganmemberinomorpadasetiapanggotapopulasidalamsuatudaftar (sample frame)

  • Selanjutnyadipergunakanjumlah digit padatabelacakdengan digit populasi

  • Pilihsalahsatunomordenganacak, gunakandua digit terakhirnya, cocokkandengannomorpadasample frame.

  • Jikaada yang sama, maka data pada sample frame diambilsebagaianggotasampel.

Diunduh dari: …af-file.googlecode.com/files/populasi-dan-sampel-.pptx... 2/9/2012


Sample size

Sample size

  • Should be based on rational analysis

    • How much variation is there?

    • How precise do you want the answer to be?

  • Too large – waste of effort

  • Too small – can not meet objectives

  • Software available to help

  • Expect to iterate

    • make objectives more modest if required sample size too large

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012


Sample size1

Sample size

Ukuransampel

Ukuransampelataujumlahsampelmenjadihal yang pentingapabilapenelitianmenggunakananalisiskuantitatif.

Padapenelitian yang menggunakananalisiskualitatif, ukuransampelbukanmenjadihalutama, yang dipentingkanadalahkekayaaninformasi. Walaujumlahsampelsedikittetapijikakayainformasi, makasampelitulebihbermanfaat.

Dalamkaitannyadenganukuransampel, selaintingkatkesalahan, adabeberapafaktor lain yang harusdipertimbangkan , yaitu: (1) derajatkeseragaman, (2) rencanaanalisis, (3) biaya, waktu, dantenaga yang tersedia .

Semakintidakseragamsifatataukaraktersetiapelemenpopulasi, semakinbanyaksampel yang harusdiambil. Jikarencanaanalisisnyamendetailataurincimakajumlahsampelharusbanyak.

Semakinsedikitwaktu, biaya , dantenaga yang dimilikipeneliti, semakinsedikit pula sampel yang dapatdiperoleh. Perludipahamibahwaapapunalasannya, penelitianharuslahdapatdikeloladenganbaik (manageable).

Menurut Gay dan Diehl (1992), untukpenelitiandeskriptif, sampelnya 10% daripopulasi; untukpenelitiankorelasional, paling sedikit 30 elemenpopulasi; untukpenelitianperbandingankausal, 30 elemen per kelompok, danuntukpenelitianeksperimen 15 elemen per kelompok.

Menurut Roscoe (1975) (dalamUmaSekaran , 1992), pedomanpenentuanjumlahsampel :

Sebaiknyaukuransampeldiantara 30 s/d 500 elemen

Jikasampeldipecahlagikedalamsubsampel (laki/perempuan, SD?SLTP/SMU, dsb), jumlah minimum subsampelharus 30

Padapenelitian multivariate (termasukanalisisregresi multivariate) ukuransampelharusbeberapa kali lebihbesar (10 kali) darijumlah variable yang akandianalisis.

Untukpenelitianeksperimen yang sederhana, denganpengendalian yang ketat, ukuransampelbisaantara 10 s/d 20 elemen.

Diunduhdari: home.unpar.ac.id/~hasan/SAMPLING ….. 2/9/2012


Common problems1

Common problems

  • Arbitrary selection of sample size

    • illegal in other disciplines!

  • ‘Rules’ which have no basis

    • ‘at least 30 farms for farmer survey’

    • ‘10% sample’

    • NB. Sample fraction (almost) never relevant

      • 50 from 5000 (=1%) gives same precision as 50 from 500000 (=0.01%)

KESALAHAN SAMPLING

In statistics, sampling error or estimation error is the amount of inaccuracy in estimating some value that is caused by only a portion of a population (i.e. a sample) rather than the whole population. This amount of inaccuracy is commonly referred to as an error.

Sampling error can be measured and quoted in many different ways, but in practice the reported error itself is almost always an estimate of the real error rather than an absolute measure of the error (which would usually require analyzing the entire population).

Sampling error is the error caused by observing a sample instead of the whole population. The sampling error can be found by subtracting the value of a parameter from the value of a statistic.

Sampling bias is a possible source of sampling errors. It leads to sampling errors which either have a prevalence to be positive or negative. Such errors can be considered to be systematic errors.

Diunduh dari: en.wikipedia.org/wiki/Sampling_error….. 2/9/2-12

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012


Sampling dan non sampling errors

Sampling dan Non-sampling errors

  • Sampling error:

    • Due to not measuring whole population

    • Described by statistical measures (eg standard error, confidence interval)

    • Control by statistical methods

  • Non-sampling error

    • Non-response

    • measurement errors

    • inaccurate sampling frame

    • Coding or data entry errors

    • Operator differences

  • Manage by good survey practice

  • Make allowance in sample size calculation

  • NB: larger not always better!

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012


Sampling error and non sampling error

Sampling Error and non-sampling Error

Definition of 'Non-Sampling Error'

A statistical error caused by human error to which a specific statistical analysis is exposed. These errors can include, but are not limited to, data entry errors, biased questions in a questionnaire, biased processing/decision making, inappropriate analysis conclusions and false information provided by respondents.

Read more: http://www.investopedia.com/terms/n/non-samplingerror.asp#ixzz25LbLQw6S


Measurement

Measurement

  • Focus on objectives, use conceptual frame

  • Only measure what you know how to use

  • There are always alternatives

    • How can you measure maize yield in a farmer’s field?

  • Check how others have done it

    • many guides and manuals available

  • Pilot EVERY measurement tool

Pengukuran (measurement, disebut juga pengamatan, observasi) adalah prosedur menentukan kualitas atau kuantitas dari karakteristik subjek penelitian yang disebut variabel.

Pengukuran variabel merupakan elemen kunci metodologi riset epidemiologi. Pengukuran yang benar terhadap variabel penelitian merupakan prinsip yang tidak dapat dikompromikan dari sebuah riset.

Pengukuran variabel menghasilkan sekumpulan nilai atau atribut dari individu-individu yang disebut data. Data dianalisis untuk menghasilkan informasi. Informasi diinterpretasikan dan digunakan oleh pengguna hasil penelitian.

Kesalahan dalam pengukuran, disebut “measurement -error”, menghasilkan data yang tidak valid, mengakibatkan hasil-hasil penelitian tidak valid, tidak benar. Kesalahan dalam pengukuran merupakan kesalahan yang sangat serius, jauh lebih serius daripada ukuran sampel (sample size) yang sering dipersoalkan oleh orang-orang yang awam dalam metodologi riset, baik di dalam maupun di luar kampus.

Ibarat orang menembak ke sasaran tembak, laras senapan yang digunakan hendaknya lurus, tidak lancung (bengkok). Senapan lancung (measurement error) tidak akan mengenai sasaran dengan benar meski digunakan berkali-kali (ukuran sampel besar).

Dikutip dari: VALIDITAS DAN RELIABILITAS PENGUKURAN . ( Prof. dr. Bhisma Murti, MPH, MSc, PhD . Institute of Health Economic and Policy Studies (IHEPS), Bagian Ilmu Kesehatan Masyarakat, Fakultas Kedokteran, Universitas Sebelas Maret ).(diunduh dari: fk.uns.ac.id/index.php/download/file/61….2/9/2012)

Diunduh dari: …www.ruforum.org/.../Surveys/Designing%20S... 25/8/2012


Merancang survei designing survey

Nonprobability/Nonrandom Sampling atau

Sampel Tidak Acak

Jenis sampel ini tidak dipilih secara acak. Tidak semua unsur atau elemen populasi mempunyai kesempatan sama untuk dapat dipilih menjadi sampel. Unsur populasi yang terpilih menjadi sampel dapat disebabkan karena kebetulan atau karena faktor lain yang sebelumnya sudah direncanakan oleh peneliti.

Convenience Sampling atau

sampel yang dipilih dengan pertimbangan kemudahan.

Dalam memilih sampel, peneliti tidak mempunyai pertimbangan lain kecuali berdasarkan kemudahan saja. Seseorang diambil sebagai sampel karena kebetulan orang tadi ada di situ atau kebetulan dia mengenal orang tersebut.

Oleh karena itu ada beberapa ahli menggunakan istilah accidental sampling – tidak disengaja – atau juga captive sample (man-on-the-street)

Jenis sampel ini sangat baik jika dimanfaatkan untuk penelitian penjajagan, yang kemudian diikuti oleh penelitian lanjutan yang sampelnya diambil secara acak (random).

Beberapa kasus penelitian yang menggunakan jenis sampel ini, hasilnya ternyata kurang obyektif.

Diunduh dari: home.unpar.ac.id/~hasan/SAMPLING…. 2/9/2012


Merancang survei designing survey

SAMPLING BOLA SALJU

Snowball Sampling – Sampel Bola Salju

Cara ini banyak dipakai ketika peneliti tidak banyak tahu tentang populasi penelitiannya. Peneliti hanya tahu satu atau dua orang yang berdasarkan penilaiannya dapat dijadikan sampel. Karena peneliti menginginkan lebih banyak lagi, lalu dia minta kepada sampel pertama untuk menunjukkan orang lain yang kira-kira dapat dijadikan sampel.

Misalnya, seorang peneliti ingin mengetahui pandangan kaum lesbian terhadap lembaga perkawinan. Peneliti cukup mencari satu orang wanita lesbian dan kemudian melakukan wawancara. Setelah selesai, peneliti tadi minta kepada wanita lesbian tersebut untuk bisa mewawancarai teman lesbian lainnya. Setelah jumlah wanita lesbian yang berhasil diwawancarainya dirasa cukup, peneliti bisa menghentikan pencarian wanita lesbian lainnya. Hal ini dapat dilakukan pada pencandu narkotik, para gay, atau kelompok-kelompok sosial lain yang eksklusif (tertutup)

Diunduh dari: home.unpar.ac.id/~hasan/SAMPLING…. 2/9/2012


Merancang survei designing survey

SAMPLING BOLA SALJU

SNOWBALL SAMPLING

Some populations that we are interested in studying can be hard-to-reach and/or hidden. These include populations such as drug addicts, homeless people, individuals with AIDS/HIV, prostitutes, and so forth. Such populations can be hard-to-reach and/or hidden because they exhibit some kind of social stigma, illicit or illegal behaviours, or other traits that makes them atypical and/or socially marginalised. Snowball sampling is a non-probability based sampling technique that can be used to gain access to such populations.

Creating a snowball sample

To create a snowball sample, there are two steps:

Try and identify one or more units in the desired population

Use these units to find further units and so on until the sample size is met

Imagine that the population we are interested in are students that download pirate music over the Internet or that take drugs. Let’s go with the latter: students that take drugs. Each student is referred to as a unit Collectively, all student drug users make up our population. However, we are only interested in examining a sample of these student drug users.

First, we need to try and find one or more units from the population we are studying (i.e. one unit would be one student that takes drugs). Finding just a small number of individuals willing to identify themselves and take part in the research may be quite difficult, so the aim is to start with just one or two students (i.e. one or two units).

Diunduhdari: http://dissertation.laerd.com/articles/snowball-sampling-an-overview.php….. 2/9/2012


Merancang survei designing survey

PURPOSIVE SAMPLING

Sampeldiambildenganmaksudatautujuantertentu. Seseorangatausesuatudiambilsebagaisampelkarenapenelitimenganggapbahwaseseorangatausesuatutersebutmemilikiinformasi yang diperlukanbagipenelitiannya.

Duajenissampelinidikenaldengannamajudgementdan quota sampling.

Judgment Sampling

Sampeldipilihberdasarkanpenilaianpenelitibahwadiaadalahpihak yang paling baikuntukdijadikansampelpenelitiannya.. Misalnyauntukmemperoleh data tentangbagaimanasatuprosesproduksidirencanakanolehsuatuperusahaan, makamanajerproduksimerupakanorang yang terbaikuntukbisamemberikaninformasi. Jadi, judment samplingumumnyamemilihsesuatuatauseseorangmenjadisampelkarenamerekamempunyai “information rich”.

Dalam program pengembanganproduk(product development), biasanya yang dijadikansampeladalahkaryawannyasendiri, denganpertimbanganbahwakalaukaryawansendiritidakpuasterhadapprodukbaru yang akandipasarkan, makajanganterlaluberharappasarakanmenerimaprodukitudenganbaik. (Cooper dan Emory, 1992).

Diunduh dari: home.unpar.ac.id/~hasan/SAMPLING…. 2/9/2012


Merancang survei designing survey

PURPOSIVE SAMPLING

Quota Sampling

Teknik sampel ini adalah bentuk dari sampel distratifikasikan secara proposional, namun tidak dipilih secara acak melainkan secara kebetulan saja.

Misalnya, di sebuah kantor terdapat pegawai laki-laki 60% dan perempuan 40% .

Jika peneliti ingin mewawancari 30 orang pegawai dari kedua jenis kelamin tadi maka dia harus mengambil sampel pegawai laki-laki sebanyak 18 orang sedangkan pegawai perempuan 12 orang.

Teknik pengambilan ketiga puluh sampel itu tidak dilakukan secara acak, melainkan secara kebetulan saja.

Diunduh dari: home.unpar.ac.id/~hasan/SAMPLING…. 2/9/2012


Merancang survei designing survey

Stratified Random Sampling atau

Sampel Acak Distratifikasikan

  • Populasi MEMPUNYAI karakteristik yang heterogen, dan heterogenitas ini mempunyai arti yang signifikan pada pencapaian tujuan penelitian, maka peneliti dapat mengambil sampel dengan cara ini.

  • Misalnya, seorang peneliti ingin mengetahui sikap “Kepala Desa” terhadap suatu kebijakan pengelolaan Lingkungan. Dia menduga bahwa “Kepala Desa” di wilayah pedesaan cenderung positif sikapnya terhadap kebijakan pengelolaan lingkungan tadi. Agar dapat menguji dugaannya tersebut maka sampelnya harus terdiri atas paling tidak para “Kepala Desa” di wilayah pedesaan, perkotaan dan pinggiran kota. Dengan teknik pemilihan sampel secara random distratifikasikan, maka dia akan memperoleh kepala-desa di ketiga wilayah tersebut. Dari setiap stratum tersebut dipilih sampel secara acak.

  • Prosedurnya adalah sbb:

    • Siapkan “sampling frame”

    • Bagi sampling frame tersebut berdasarkan strata yang dikehendaki

    • Tentukan jumlah sampel dalam setiap stratum

    • Memilih sampel kepala-desa dari setiap stratum secara acak.

  • Pada saat menentukan jumlah sampel dalam setiap stratum, peneliti dapat menentukan secara (a) proposional, atau (b) tidak proposional. “Proposional” berarti jumlah sampel dalam setiap stratum sebanding dengan jumlah unsur populasi dalam stratum tersebut.

  • Misalnya, untuk stratum kepala-desa di wilayah pedesaan (I) terdapat 15 orang, di wilayah pinggiran 45 orang (II), dan di wilayah perkotaan (III) ada 100 orang. Artinya jumlah seluruh kepala-desa ada 160 orang. Kalau jumlah sampel yang akan diambil seluruhnya 100 kepala-desa, maka untuk stratum I diambil (15:160)x100 = 9 orang, stratum II = 28 orangh, dan stratum 3 = 63 orang.

  • Jumlah sampel dalam setiap stratum “tidak – proposional”, jika jumlah unsur atau elemen di salah satu atau beberapa stratum sangat sedikit. Misalnya saja, kalau dalam stratum kepala desa strata I hanya ada 4 orang, maka peneliti dapat mengambil semua kepala-desa dalam stratum tersebut , dan untuk kepala-desa stratum II ditambah 5, sedangkan kepala-desa stratum III, tetap 63 orang.

Diunduh dari: home.unpar.ac.id/~hasan/SAMPLING…. 2/9/2012


Merancang survei designing survey

Cluster Sampling atauSampelGerombol

Teknik ini biasa juga disebut cara pengambilan sampel berdasarkan gugus.

Dalam teknik pengambilan sampel acak yang distratifikasikan, setiap unsur dalam satu stratum memiliki karakteristik yang homogen (stratum A : laki-laki semua, stratum B : perempuan semua).

Dalam sampel gugus, setiap gugus boleh mengandung unsur yang karakteristiknya berbeda-beda atau heterogen.

Misalnya, dalam satu kabupaten terdapat 100 kawasan persawahan. Dalam setiap kawasan sawah terdapat banyak jenis padi dengan karakteristik berbeda. Beda umurnya, beda tingkat produksinya, beda cara penanamannya, beda cara panennya, dan perbedaan-perbedaan lainnya.

Jika peneliti bermaksud mengetahui tingkat respon padi terhadap suatu strategi pemupukan yang akan diterapkan oleh petani, maka peneliti dapat menggunakan cluster sampling untuk mencegah terpilihnya sampel hanya dari satu atau dua kaweasan sawah saja.

Diunduh dari: home.unpar.ac.id/~hasan/SAMPLING…. 2/9/2012


Merancang survei designing survey

Cluster Sampling atauSampelGugus

  • Prosedurnyaadalahsbb :

    • Susun sampling frame berdasarkangugus – Dalamkasusdiatas, elemennyaada 100 kawasansawah.

    • Tentukanberapagugus yang akandiambilsebagaisampel

    • Pilihgugussebagaisampeldengancaraacak

    • Telitisetiappegawai yang adadalamgugus sample (sampelkawasansawah).

Diunduh dari: home.unpar.ac.id/~hasan/SAMPLING…. 2/9/2012


Merancang survei designing survey

Systematic Sampling atau Sampel Sistematis

Jikapenelitidihadapkanpadaukuranpopulasi yang banyakdantidakmemilikialatpengambil data secara random, makadapatdigunakancarapengambilansampelsistematis.

Cara inimenuntutkepadapenelitiuntukmemilihunsurpopulasisecarasistematis, yaituunsurpopulasi yang dapatdijadikansampeladalah yang “keberapa”.

Misalnya, setiapunsurpopulasi yang keenam, yang dapatdijadikansampel. Soal “keberapa” -nyasatuunsurpopulasidapatdijadikansampeltergantungpadaukuranpopulasidanukuransampel.

Misalnya, dalamsatupopulasihutanjatiada 5000 tegakan (pohon) jati. Sampel yang akandiambiladalah 250 pohondengandemikian interval diantarasampelkesatu, kedua, danseterusnyaadalah 25.

Diunduh dari: home.unpar.ac.id/~hasan/SAMPLING…. 2/9/2012


Merancang survei designing survey

Systematic Sampling atau Sampel Sistematis

  • Prosedurnyasbb:

    • Menyusunsampling frame

    • Menetapkanjumlahsampel yang ingindiambil

    • Menentukan K (kelas interval)

    • Menentukanangkaataunomorawaldiantarakelas interval tersebutsecaraacakatau random – biasanyamelaluicaraundiansaja.

    • Memulaimengambilsampeldimulaidariangkaataunomorawal yang terpilih.

    • Memilihsebagaisampelangkaataunomor interval berikutnya

Diunduh dari: home.unpar.ac.id/~hasan/SAMPLING…. 2/9/2012


Merancang survei designing survey

Area Sampling atau Sampel Wilayah

  • Teknik ini dapat digunakan kalau populasi penelitiannya tersebar di berbagai wilayah.

  • Misalnya, seorang penyuluh pertanian lapangan ingin mengetahui tingkat penerimaan petani di Kabupaten Malang atas sebuah program-penyuluhan pertanian, teknik pengambilan sampel dengan area sampling sangat tepat.

  • Prosedurnya adalah:

    • Menyusun sampling frame yang menggambarkan peta wilayah (Kabupaten Malang) – Kecamatan, dan Desa.

    • Menentukan wilayah yang akan dijadikan sampel (Kecamatan mana ?, Desa mana?)

    • Menentukan berapa wilayah yang akan dijadikan sampel penelitiannya.

    • Memilih beberapa wilayah untuk dijadikan sampel dengan cara acak atau random.

    • Kalau ternyata masih terlampau banyak responden yang harus diambil datanya; maka wilayah yang terpilih dapat dibagi lagi menjadi beberapa sub wilayah.

Diunduh dari: home.unpar.ac.id/~hasan/SAMPLING…. 2/9/2012


Merancang survei designing survey

Area Sampling atau Sampel Wilayah

Diunduhdari: http://www.stat.colostate.edu/~nsu/starmap/pps/Presentations/Stevens.Olsen.JSM%20Short%20Course.2006.pdf...2/9/2012


Merancang survei designing survey

METODE SURVEI DALAM

KAJIAN LINGKUNGAN


  • Login