Building the Right Multiple Sequence Alignment.
Sponsored Links
This presentation is the property of its rightful owner.
1 / 34

Building the Right Multiple Sequence Alignment. PowerPoint PPT Presentation

  • Uploaded on
  • Presentation posted in: General

Building the Right Multiple Sequence Alignment. Recognizing The Right Sequences When you Meet Them…. Gathering Sequences: BLAST. Common Mistake: Sequences Too Closely Related. PRVA_MACFU SMTDLLNAEDIKKAVGAFSAIDSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEE

Download Presentation

Building the Right Multiple Sequence Alignment.

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript

Building the right multiple sequence alignment

Building the Right Multiple Sequence Alignment.

Building the right multiple sequence alignment

Recognizing The Right Sequences When you Meet Them…

Building the right multiple sequence alignment

Gathering Sequences: BLAST

Building the right multiple sequence alignment

Common Mistake:

Sequences Too Closely Related







:**::*.*******:***:* :****************..::******:***********







:*** ******.******.**** *:************.:******:**



Building the right multiple sequence alignment

Sequence Weighting Within ClustalW

Building the right multiple sequence alignment

Selecting Diverse Sequences (Opus II)

Building the right multiple sequence alignment

This Alignment Is not Informative about the relation Betwwen TPCC MOUSE and the rest of the sequences.

-A better Spread of the Sequences is needed

Respect Information!

PRVA_MACFU ------------------------------------------SMTDLLN----AEDIKKA

PRVA_HUMAN ------------------------------------------SMTDLLN----AEDIKKA

PRVA_GERSP ------------------------------------------SMTDLLS----AEDIKKA

PRVA_MOUSE ------------------------------------------SMTDVLS----AEDIKKA

PRVA_RAT ------------------------------------------SMTDLLS----AEDIKKA

PRVA_RABIT ------------------------------------------AMTELLN----AEDIKKA


: :*. .*::::








Building the right multiple sequence alignment

Selecting Diverse Sequences (Opus II)

Building the right multiple sequence alignment

Selecting Diverse Sequences (Opus II)








: *: .: . .* .:*. * ** *: * : * :* * **:**








:** .*:.* .* *: ** :: .* **** **::** **

-A REASONABLE Model Now Exists.

-Going Further:Remote Homologues.

Building the right multiple sequence alignment

Aligning Remote Homologues

PRVA_MACFU ------------------------------------------SMTDLLNA----EDIKKA

PRVA_ESOLU -------------------------------------------AKDLLKA----DDIKKA

PRVB_CYPCA ------------------------------------------AFAGVLND----ADIAAA

PRVB_BOACO ------------------------------------------AFAGILSD----ADIAAG

PRV1_SALSA -----------------------------------------MACAHLCKE----ADIKTA

PRVB_LATCH ------------------------------------------AVAKLLAA----ADVTAA

PRVB_RANES ------------------------------------------SITDIVSE----KDIDAA




: ::











: . .: .. . *: * : * :* : .*:*: :** .











:: .. :: : :: .* :.** *. :** ::

Building the right multiple sequence alignment


Building the right multiple sequence alignment

Do Not Use Two Many Sequences…

Building the right multiple sequence alignment

Reading Your Alignment

Building the right multiple sequence alignment

Going Further…








. : .. . :: . : * :* : .* *. : * .








: . :: : :: * :..* :. :** ::

Building the right multiple sequence alignment






    • Completely Conserved

    • Conserved For Size and Hydropathy

    • Conserved For Size or Hydropathy


Building the right multiple sequence alignment

Potential Difficulties

Building the right multiple sequence alignment






***. ::: .: .. . : . . * . *: *



trybr AEKDKERYKREM---------


* : .* . :






***. :*: .: .. . : . . * . *: *



trybr AEKDKERYKREM---------


* : .* . :

Building the right multiple sequence alignment





    • GOP/ GEP

    • MATRIX


Substitution Matrices

(Etzold and al. 1993)

Gonnet61.7 %

Blosum5059.7 %

Pam25059.2 %





Building the right multiple sequence alignment






***. ::: .: .. . : . . * . *: *






* *** .:: ::... : * . . . : * . *: *


Building the right multiple sequence alignment




Building the right multiple sequence alignment

Naming Your Sequences The Right Way

Building the right multiple sequence alignment

Choosing the right method

Building the right multiple sequence alignment

Situation  Solution

Building the right multiple sequence alignment

Priority  Solution

Building the right multiple sequence alignment

Purpose  Solution

Building the right multiple sequence alignment


Building the right multiple sequence alignment

-The BEST alignment Method:

Your Brain

The Right Data

-The Best Evaluation Procedure:

Experimental Data (SwissProt)

-Choosing The Sequences Well is Important

-Beware of repeated elements

Multiple Alignment

Building the right multiple sequence alignment

Multiple Alignment

Know Your Problem: What do you want to do with your MSA

Building the right multiple sequence alignment


  • Login