Dinas perizinan kota yogyakarta
This presentation is the property of its rightful owner.
Sponsored Links
1 / 36


  • Uploaded on
  • Presentation posted in: General

DINAS PERIZINAN KOTA YOGYAKARTA. SOSIALISASI. “ Mekanisme Pelayanan Perizinan Di Kota Yogyakarta ” Yogyakarta, 14 Nop 2012. Yogyakarta, 24 April 2013. DASAR HUKUM.

Download Presentation


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript




Di Kota Yogyakarta ”

Yogyakarta, 14 Nop 2012

Yogyakarta, 24 April 2013


  • Peraturan Daerah Kota Yogyakarta Nomor 10 Tahun 2008 Tentang Pembentukan, Susunan, Kedudukan Dan Tugas Pokok Dinas Daerah.

  • Peraturan Walikota Yogyakarta Nomor 85 Tahun 2008 Tentang Fungsi,

  • Rincian Tugas dan Tata Kerja Dinas Perizinan Kota Yogyakarta

  • Peraturan Walikota Yogyakarta Nomor 18 Tahun 2011 Tentang Penyelenggaraan Perizinan Pada Pemerintah Kota Yogyakarta

  • Peraturan Walikota Yogyakarta Nomor 37 Tahun 2011 Tentang Penetapan Persyaratan Perizinan dan Waktu Pelayanan

  • Keputusan Ka. Dinas Perizinan Kota Yogyakarta Nomor 46/KEP/DINZIN/ 2011 tentang Penetapan Bentuk Format Dan Isi Formulir Permohonan,Keputusan Izin,Surat Izin Dan Tanda Daftar

  • Keputusan Ka. Dinas Perizinan Kota Yogyakarta Nomor 47/KEP/DINZIN/ 2011 tentang Penetapan Sistem dan Prosedur Pelayanan Perizinan pada Dinas Perizinan Kota Yogyakarta.

  • Keputusan Ka. Dinas Perizinan Kota Yogyakarta Nomor 48/KEP/DINZIN/2011 tentang Pelimpahan Sebagian Kewenangan Ka. Dinas Perizinan kepada Pejabat Struktural Eselon III Di Dinas Perizinan Untuk Menandatangani Perizinan


















Pelayanan Perizinaan melalui sistem PTSP (Pelayanan Terpadu Satu Pintu)

  • PTSP adalah kegiatan penyelenggaraan suatu perizinan dan non perizinan yang mendapat pendelegasian atau pelimpahan wewenang dari lembaga atau instansi yang memiliki kewenangan perizinan dan non perizinan yang proses pengelolaannya dimulai dari tahap permohonan sampai tahap diterbitkannya dokumen yang dilakukan dalam satu tempat.

Pemerintah Kota Yogyakarta

Membentuk Kelembagaan PTSP dengan nama:

“ DINAS PERIZINAN Kota Yogyakarta ”.

  • Sebagai sarana memenuhi harapan masyarakat.





















































    - Usaha / kegiatanuntukmembantu / menyiapkan/ menyediakan /mengurus / memenuhikebutuhan / apa yang diperlukanpelanggan.

    - Kegiatanmelayani, membantumenyiapkankeperluanpelangganorang lain / sekelompokorang

    - Cara, teknikataukemampuandalammemenuhi / menanggapikepentingan / kebutuhanorang / pihak lain

  • PRIMA :

    - Optimal / maksimal / terbaik / sempurna / unggul

Penyelenggaraan Perizinan pada

Dinas Perizinan Kota Yogyakarta










“Terwujudnya Pelayanan Yang Pasti Dalam Biaya , Waktu, Persyaratan dan Akuntabel Di bidang Perizinan “


  • Untuk Mewujudkan Visi Tersebut Dinas PerizinanMempunyai

  • Misi :

  • Melaksanakan Pelayanan Internal;

  • Meningkatkan SDM yang Berkualitas;

  • Melaksanakan Pelayanan Perizinan sesuai dengan Kewenanggannya

  • Melaksanakan Pengawasan dan Penyelesaian Pengaduan Perizinan dan Advokasi

  • Melaksanakan Pengelolaan Data dan Sistem Informasi

  • Melaksanakan Pengkajian Perizinan/regulasi dan Pengembangan kinerja


Pastidalampersyaratan, waktu, biaya, danpastidiizinkanatauditolak

Kebijakan Mutu

“Dinas Perizinan Kota Yogyakarta bertekat melayani masyarakat dengan Mudah, Cepat, Pasti, Transparan, Adil dan Akuntabel “

(Sendi-sendi Pelayanan Prima)

Peran Masyarakat dalam proses pengambilan kebijakan/keputusan

  • Penyusunan Regulasi Perizinan, pada proses menjaring aspirasi masyarakat/publik Hearing.

  • Penyusunan Dokumen lingkungan, pada proses sosialisasi dan pembahasan.

  • Pengajuan Izin, pada proses persetujuan tetangga, Rt, Rw, Lurah dan Camat.

  • Penyusunan SPP, pada proses pembahasan yang melibatkan unsur Akademisi, Asosiasi, Tokoh masyarakat dan pelaku usaha.

  • Penyampaian saran, keluhan dan pengaduan lewat kuesioner IKM.


Sebagai sarana pengendalian dan Perlindungan Hukum,

Menjamin Kepastian hukum dalam berusaha/LEGALITAS,

Menjamin iklim usaha yang kondusif,

Melindungi Kepentingan umum , serta

Memelihara lingkungan hidup.


Peraturan Walikota Yogyakarta No 18 Tahun 2011

  • Izin MendirikanBangunan (IMB)

  • Izin In Gang( Izinpembuatanjalanmasuk)

  • Izin Saluran Air Limbah (SAL)

  • Izin Penyambungan Saluran Air Hujan (SAH)

  • Izin Gangguan (HO)

  • Izin Usaha Industri (IUI) dan Tanda Daftar Industri (TDI)

  • Surat Izin Usaha Perdagangan (SIUP)

  • Surat Izin Usaha Perdagangan MinumanBeralkohol(SIUP MB)

  • Izin Usaha Angkutan

  • SuratIzin Usaha JasaKonstruksi (SIUJK)

  • Izin Usaha PengelolaanPasarTradisional (IUP2T)

  • Izin Usaha PusatPerbelanjaan (IUPP)

  • Izin Usaha Pasar Modern (IUTM)

  • TandaDartar Usaha Pariwisata

  • IzinPemakaiandanPengusahaan Air Tanah

  • .


  • Izin Perusahaan Pengeboran Air Bawah Tanah

  • Izin Juru Bor Air Bawah Tanah

  • IzinPemakamanUntuk :

  • PengelolaanTempatPemakamanUmumSwasta

  • PengelolaanKrematoriumMilikSwasta

  • PngelolaanTempatPenyimpanan Abu JenasahMilikSwasta

  • Izin Salon Kencatikan

  • Izin Pendirian Lembaga Pendidikan Formal

  • IzinPendirianLembagaPendidikan Non Formal

  • Izin Penjual Daging

  • IzinPengusahaPenggilinganDaging

  • IzinPengusahaPenyimpananDaging

  • IzinPenelitian

  • IzinPraktekKerjaLapangan (PKL)

  • IzinKuliahKerjaNyata (KKN)

  • TandaDaftarGudang (TDG)

  • TandaDaftar Perusahaan (TDP)

  • SuratTandaPendaftaranWaralaba (STPW)



ProsedurPelayananIzinLicense servisce Procedure




Forms Cheking



Field Cheking


Letter Of Rejection

Proses SK IzindanPenetapanLicences Decision Letter Process

And Determinition





Standar Waktu Proses Penyelesaian izin


  • Penandatanganan izin oleh kepala Dinas Perizinan;

  • Apabila Kepala Dinas berhalangan kurang dari 7 (tujuh) hari, penandatangan izin dilakukan oleh pejabat struktural dibawahnya (atas nama kepala Dinas).

  • Apabila Kepala Dinas berhalangan lebih dari 7 (tujuh) hari, penandatangan izin dilakukan oleh Pejabat Pelaksana Harian (Plh).

  • Untuk meningkatkan kelancaran perizinan di Dinas Perizinan Kota Yogyakarta, ada Pelimpahan sebagian kewenangan Kepala Dinas Perizinan Kepada Pejabat Struktural Eselon III di Dinas Perizinan untuk menandatangani Perizinan ditetapkan Keputusan Kepala Dinas Perizinan.

  • Index Kepuasan Layanan

Keputusan Menteri Pendayagunaan Apartur Negara

Nomor : KEP/ 25 / M.PAN/2/2004

Data atauinformasimengenaitingkatkepuasanmasyarakat yang diperolehdarihasilpengukuransecarakuantitatifdankualitatifataspendapatmasyarakatdalammemperolehpelayanandariaparaturpenyelenggarapelayananpublikdenganmembandingkanantaraharapandengankebutuhannya.

Indeks Kepuasan Mayarakat (IKM) :




Nilai IKM PelayananPerizinandiDinasPerizinan Kota Yogyakarta Tahun 2013 (Triwulan I )









begitu aku

juga puas



Pengakuan Mutu Pelayanan Dinas Perizinan Kota Yogyakarta

1. Self Assessment, dilakukanolehorganisasisendiriuntukmenilaikinerjamutu IKM kategori “SangatBaik”.

2. ISO, 9001:2008, dilakukanolehbadaneksternal (WQA) berupasertifikasiterhadapmanajemenmutuberskala international sejaktahun 2010.

3. Akreditasi, dilakukanolehbadaneksternal (BKPM) mendapatsertifikasi “BINTANG” terhadapmanajemenmutuberskalanasional.

4. Akreditasi, dilakukanolehIFCbekerjasamadenganKomitePemantauPelaksanaanOtonomi Daerah (KPPOD) dalamDoing Business padaTahun 2012 mendudukiposisi 4(empar) besardari 183 Negara berskala international, danperingkat 1 (satu) skalanasionalterhadapkemudahanmendirikanusahadanmendirikanbangunan.

SISTIM PENGENDALIAN INTERNAL:A. Penandatangan Pakta Integritas; B. Kode Etik Pegawai Dinas Perizinan;C. Majelis Kode Etik;


  • Bertekatmelayanaimasyarakatdenganmudah, cepat, pasti, transparan, adildanakuntabel;

  • Bertekatmelaksanakantugaskedinasandenganpenuhdedikasidan rasa tanggungjawabdalammemberikanpelayanan;

  • Bertekattidakakanmenyalahgunakanjabatan, wewenangdantidakmelakukanpungutan yang tidaksahdalammemberikanpelayanan;

  • Bertekattidakakanmenerimapemberian/gratifikasidalambentukapapun yang berkaitandenganpemberianpelayanan;

  • Bertekatsalingmenghormati, bekerjasama, danmenciptakansuasanahubungankerja yang harmonisdengansesamapegawaidalammemberikanpelayanan;

  • SiapmelaksanakanBudayaKerja yang Ramah, Rapidalamberpakaian, Disiplin, Cermat, InovatifdanBertanggungjawab.

Jenis-jenis izin yang dilimpahkan di tingkat kecamatan:


  • IzinGangguandikawasanpemukimanjenisgangguankecildanmenengah, dankhususdikecamatanKratondiKawasanKhususdiwilayahKratondengangangguankecildanmenengah.

  • IzinGangguanuntukusahaPemondokandanIzinPenyelenggaraPemondokan.

  • IMB yaituuntukbangunankeluasansampaidengan 100 M2, tidakbertingkat, fungsibangunanrumahtinggaldandidalamkampungdantidakditepijalan yang memiliki/bergarissempadan.

  • IzinPenyelenggaraPemondokan.

  • IzinLokasiPedagang Kaki lima (PKL).

  • IzinPemakaman.

Prinsip dan sasaran penetapan retribusi

  • Retribusi Izin Mendirikan Bangunan dan Izin Gangguan didasarkan pada tujuan untuk menutup sebagian atau seluruh biaya penyelenggaraan pemberian izin .

Fasilitas dalam proses pelayanan perizinan

  • Routing slip adalah lembar kendali yang diaplikasikan melalui suatu sistem

  • Lewat aplikasi routing slip proses izin dapat dipantau setiap proses/tahapannya

  • Disampinguntukpengendalian internal, masyarakat/ pemohondapatmengetahuiprosesizinmerekaMelalui :

  • 1.TouchsreenAntriandanInformasidenganmemasukannomor

  • pendaftaranpermohonanizin

2. Sub Domain dengan alamat http:// perizinan. jogjakota.go.id

3. SMS Center : ketik Status (spasi) nomor pendaftaran

kirim ke 0812287300000


  • Advice Panning.

  • Petugas Penghubung.

  • Pelayanan Perizinan secara “ONLINE”

SaranaPengaduan yang tersedia:

  • Unit Pelayanan Informasi dan Keluhan (UPIK) dengan sms ke no 2740 atau 081 227 80001

  • E-mail : [email protected]

  • E-mail Intranet: [email protected]

  • Faximile No (0274) 555 241

  • Telepon No (0274) 555 241

  • Melalui surat dengan alamat Dinas Perizinan Kota Yogyakarta Jl Kenari No 56 Yogyakarta 55165

  • Datang langsung ke Dinas Perizinan Kota Yogyakarta dengan mengisi formulir pengaduan;

  • Hot Line SMS di Dinas Perizinan Kota Yogyakarta Nomor. 081 227 62 5000




  • Login