Masalah dan potensi masalah pada pemilu 2014
This presentation is the property of its rightful owner.
Sponsored Links
1 / 17

Masalah dan Potensi Masalah Pada Pemilu 2014 PowerPoint PPT Presentation


  • 149 Views
  • Uploaded on
  • Presentation posted in: General

Masalah dan Potensi Masalah Pada Pemilu 2014. Oleh Arief Budiman ( Komisioner KPU RI). TAHAPAN, PROGRAM DAN JADWAL PEMILU 2014. TAHAPAN PEMILU YANG SUDAH TUNTAS. Perencanaan program, anggaran dan Penyusunan peraturan. Pendaftaran dan verifikasi peserta Pemilu. Penetapan peserta Pemilu.

Download Presentation

Masalah dan Potensi Masalah Pada Pemilu 2014

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


Masalah dan potensi masalah pada pemilu 2014

Masalahdan Potensi Masalah Pada Pemilu 2014

Oleh

Arief Budiman

(Komisioner KPU RI)


Masalah dan potensi masalah pada pemilu 2014

TAHAPAN, PROGRAM DAN JADWAL PEMILU 2014


Masalah dan potensi masalah pada pemilu 2014

TAHAPAN PEMILU YANG SUDAH TUNTAS

Perencanaan program, anggarandanPenyusunanperaturan

PendaftarandanverifikasipesertaPemilu

PenetapanpesertaPemilu

Tahapan Yang SudahTuntas

Penetapanjumlahkursidandaerahpemilihan

Pencalonananggota DPR, DPD, DPRD Provinsidan DPRD Kabupaten/Kota

Pemutakhiran data pemilihdanpenyusunandaftarpemilih


Masalah dan potensi masalah pada pemilu 2014

TAHAPAN YANG SEDANG DAN AKAN BERJALAN

Tahapan Yang SedangBerjalan

Pelaksanaankampanye

Masatenang

Pemungutandanpenghitungansuara

Tahapan Yang AkanBerjalan

PenetapanHasilPemilu

Pengucapansumpah/janjianggota DPR, DPD dan DPRD


Masalah dan potensi masalah pada pemilu 2014

MasalahPadaTahapanPemilu

TahapPendaftarandanVerifikasiParpol

PartaipolitiktidaksepenuhnyadapatmengoperasionalkanSipol

Putusan MK Nomor 52/PUU-X/2012 yang mewajibkansemuaparpolcalonpesertaPemiluwajibmengikutiverifikasi

ParpolcalonpesertaPemilusebagianbesarmenyerahkanpersyaratanmenjelangbatasakhirpendaftaran

KPU butuhwaktu yang lebihpanjanguntukmencermati data-data parpolkarena data yang diserahkanparpoldalambentuk manual

Putusan DKPP No.23-25/DKPP-PKE-I/2012 yang memerintahkan KPU melakukanverifikasifaktualterhadap 18 parpol yang tidaklolosverifikasiadministrasi

KPU membutuhkantambahananggaranuntukmelakukanverifikasifaktual 18 parpol yang dinyatakantidaklolosverifikasiadministrasi

Kebijakanafirmatif action 30 persenperempuandalamkepengurusanparpoltingkatpusat, provinsidankabupaten/kotadiprotesparpol


Masalah dan potensi masalah pada pemilu 2014

MasalahPadaTahapanPemilu

Kebijakan KPU untukPenanganannya

PerpanjanganmasapendaftaranpartaipolitikcalonpesertaPemilu 2014

PerpanjanganwaktuverifikasiadministrasipartaipolitikcalonpesertaPemiludengancaramengubahperaturantentangtahapan, program danjadwal

Mengorganisirkelompokkerja (Pokja) verifikasiuntukkembalimelakukanverifikasifaktualterhadap 18 parpoldisetiapjenjang

Memaksimalkansisaanggaranverifikasifaktual 16 parpol

Memintabantuanpemerintahuntukmemfasilitasipelaksanaanverifikasifaktual 18 parpol yang dinyatakantidaklolosverifikasiadministrasi

PlenoterbukapenetapanparpolpesertaPemilusecaraberjenjang

Memberikankesempatankepadaparpoluntukadu data terhadaphal-hal yang dianggaptidakmemenuhisyarat (TMS)


Masalah dan potensi masalah pada pemilu 2014

MasalahPadaTahapanPemilu

TahapPenataan Daerah PemilihandanAlokasiKursi

Pembentukandaerahotonomibaru (DOB) olehpemerintahsebelumpelaksanaanPemilu

Terdapatkabupaten/kota yang tidakbisadijadikansatudaerahpemilihankarenakonversijumlahpendudukdengankursikurangdari 3 kursi

Penyebaranpenduduk yang tidakmeratadisejumlahdaerahsehinggamengakibatkanterdapatdapildengangeografis yang sangatluastetapijumlahkursinyasedikit

Tuntutandibeberapadaerahuntukmemperhatikanrepresentasisuku, budayadankedekatansecarageografisdalampembentukandapil

Perbedaan DAK2 milikKemendagridenganPemerintah Daerah


Masalah dan potensi masalah pada pemilu 2014

MasalahPadaTahapanPemilu

Kebijakan KPU untukPenanganannya

PenataanDapildilakukandenganmemperhatikanbatas-bataswilayahdaerahindukdengan DOB

Alokasikursidandapiluntuk DOB ditatasetelahpelaksanaanPemilu

KPU menggunakan DAK2 Kemendagriuntukmenetapkandapildanmelakukankomunikasipersuasifkepadadaerah yang menilai DAK2 Kemendgaribermasalah

KPU menggelarkonsultasipublikdalampenataandapildisetiaptingkatanuntukmenyerapaspirasimasyarakatdanmemastikandapilbenar-benarrepresentatif

KPU konsistendenganrumusanpenataandapilyaknikesetaraannilaisuara, ketaatanpadasistempemiluproporsional, proporsionalitas, integritaswilayah, coterminous, kohesivitasdankesinambungan

Daerah dengankonversijumlahpendudukmenjadikursikurangdari 3, dapilnyadigabungdengandaerah lain


Masalah dan potensi masalah pada pemilu 2014

MasalahPadaTahapanPemilu

TahapPencalonanAnggota DPR, DPD dan DPRD

Kurangnyapemahamancalegterhadapkelengkapanpersyaratanadministrasipencalonan

Informasitentangpemenuhankelengkapanpersyaratancalondaripengubungparpolkurangmaksimalkepadaparasetiapcaleg

Beberapacalegterkendaladengan KTP sebagaisyaratpencalonankarenapencetakan e-KTP belumrampung, sementara KTP lama sudahditarik

Sejumlahbacalegpencalonannyaganda/terindikasigandabaikgandadidaerahpemilihan (dapil) maupungandaparpol

Partaipolitikmenggugatkeputusan KPU tentangpenetapan DCS yang mencoret lima parpoldi 8 dapilkarenatidakmemenuhikuota 30 persenperempuan

Putusan MK Nomor 39/PUU-XI/2013 yang membatalkanpasal 16 ayat 3 UU Nomor 2 Tahun 2011 tentangkewajibanmengundurkandiribagianggota DPRD dariparpol yang gagalmenjadipesertaPemilu yang akanmajulagimenjadicalegdariparpolpesertaPemilu


Masalah dan potensi masalah pada pemilu 2014

MasalahPadaTahapanPemilu

Kebijakan KPU UntukPenanganannya

Mengoptimalkanperan help desk untukmemberikanlayananinformasidankonsultasikepadaparpol

Mendorongparpoluntukmengoptimalkanfungsipenghubungdalammenyampaikansegalainformasikepadaparpoldanparacaleg

Untukpersoalan KTP, paracalegdapatmemintasuratketerangandariaparaturpemerintahansetempat

Mengembalikancaleggandadanterindikasigandakepadaparpoluntukdiperbaiki

KPU melakukanperubahankeputusantentangpenetapan DCS berdasarkanrekomendasiBawaslu

KPU RI mengeluarkansuratedarannomor 554/KPU/VIII/2013 tentangPenjelasanTerkaitPutusan MK Nomor 39/PUU-XI/2013


Masalah dan potensi masalah pada pemilu 2014

MasalahPadaTahapanPemilu

TahapPemutakhiran Data PemilihdanPenyusunanDaftarPemilih

Dari 190.463.184 DP4 yang diserahkanpemerintah, hanya175.142.000 data merupakan yang hasil perekaman KTP elektronik

Dari 175.142.000 DP4hasilperekaman KTP elektronik, baru 148 juta e-KTP yang tercetak

Dari 190.463.184 DP4, sebanyak 1,8 juta DP4 terdeteksiganda, 65 jutatanpa NIK, 40 jutatidakmemilikiketerangan RT dan 50 jutatidakmemilikiketerangan RW, 77 ribupemilihbelumberumur 17 tahun, dan 3228 NIK sama

Pencairan honor Pantarlih, PPS dan PPK terlambatsehinggamengakibatkanpengumpulan data daribawahjugamenjaditerhambat

DPS minim masukandantanggapandarimasyarakatdanparpol

Kondisigeografisdisejumlahdaerahsulitsehinggapengiriman data dari PPS keKabupaten/Kota terlambat

Jaringan internet disejumlahdaerahseringbermasalahsehinggapengiriman data daridaerahkepusatterhambat


Masalah dan potensi masalah pada pemilu 2014

MasalahPadaTahapanPemilu

Kebijakan KPU UntukPenanganannya

KPU menggunakanSidalihuntukkonsolidasidandistribusi data Pemilih

KPU secarasistemikmenghapus data ganda K1 danmelakukanverifikasifaktualkembaliterhadap data ganda K2

Mengumumkan DPS, DPSHP, DPSHPA dan DPT secara manual dan online untukmempermudahmasyarakatmengaksesnya

Memperpanjangmasapengumumandantanggapanmasyarakatterhadap DPSHP

Menggelarplenoterbukapenetapan DPT secaraberjenjang

Melakukanpenyandingan data DPSHP dan DPT dengan DP4 milikKemendagri

MenindaklanjutirekomendasiBawasluuntukmenundapenetapan DPT danmencermatiulang DPT yang sudahditetapkan

Konsolidasi operator Sidalihseluruh Indonesia mulaitingkatkabupaten/kotadiprovinsidantingkatprovinsidipusatuntukmerapikan DPT

Verifikasiulangkelapanganterhadap DPT dengan NIK invalid untukmemastikankeberadaanorangnya

Membahasprogresperbaikan DPT bersamaKemendagri, Bawaslu, utusanParpol, DKPP, danKomisi II


Masalah dan potensi masalah pada pemilu 2014

PotensiMasalahPadaTahapanPemilu

PotensiMasalahpadaTahapKampanye

Pemanfaatanjabatanolehparapolitisiuntukmengkampanyekandirinyakepadapubliklewatiklanlayananmasyarakat (ILM)

Penggunaan media massauntukkegiatankampanyesecaraterselubungdanberlebihanolehparapemilik media yang jugaberstatussebagaipolitisidiluarjadwal yang diperbolehkan

Penggunaan media sosialanonimuntukmenyerangdanmelakukankampanyehitamantarpesertaPemiludankandidat

Pengumpulansumbangandanakampanyemelebihibatasmaksimal yang sudahditentukan

Pemanfaatanjabatanolehparapolitisiuntukmengkonsolidasikankegiatan-kegiatansosialmenjelangpelaksanaanPemilu 2014

Politikuangdengan motif kegiatansosialolehpesertaPemiluterutamadisegmenmasyarakat yang rentan

Menggunakanfasilitaspemerintah, tempatibadahdantempatpendidikanuntukkegiatankampanyeterselubung

Diskriminasidalampenggunaanfasilitasumumuntukkegiatankampanyeparpoldancalegtertentu


Masalah dan potensi masalah pada pemilu 2014

PotensiMasalahPadaTahapanPemilu

Kebijakan KPU UntukAntisipasinya

Laranganpejabatnegara, pimpinandananggota DPRD yang menjadicalonanggota DPR, DPD dan DPRD menjadipemeraniklanlayananmasyarakatpadainstitusinya

Pengaturanpemasanganbaliho, billboard danspandukuntuksetiapparpoldancaleg

Pelaporandanakampanyeparpolsecaraberkalake KPU yang didalamnyaterdapatlaporandanakampanyecaleg

Penetapanzonadan media pemasanganalatperagakampanyebekerjasamadenganPemerintah Daerah

Pengaturanzonadanjadwalkampanyeuntuksetiapparpol

KPU, Bawasludan KPI membentuk Task Force dengantugasmelakukanpengawasandananalisaiklankampanyeuntukmenyamakansikapdanpersepsi

Mendorong KPI danDewanPersmemberikansanksi yang tegasterhadap media yang melanggarpemuatanberita, siarandaniklankampanye


Masalah dan potensi masalah pada pemilu 2014

PotensiMasalahPadaTahapanPemilu

TahapPemungutan, PenghitungandanRekapitulasiSuara

Intimidasi, suapdankekerasanterhadappenyelenggara, saksidanpemilih

Penggelembungansuara

Manipulasisuaradenganmenukarformulir C1

Pemalsuanidentitas

Mencoblossuratsuarasisa

Mencobloslebihdarisatu kali

Menghalang-halangipengawasdansaksiuntukmendapatkanformulir C1


Masalah dan potensi masalah pada pemilu 2014

PotensiMasalahPadaTahapanPemilu

Kebijakan KPU UntukAntisipasinya

  • Penandaankhususuntukformulir C1 dan C1 plano

Mengunggahhasilpemindaianrekapperolehansuaradi TPS (formulir C1) ke server KPU

Pengunggahanformulir C1 ditingkatkabupaten/kotadilakukantanpamenunggurekapdi PPS dan PPK

Petugas PPS dan PPK jugawajibmengunggahhasilrekapitulasidi PPS dan PPK ke server KPU

Formulir C1 planowajibdibukasaatrekapitulasidi PPS

Memperbolehkanmasyarakatuntukmendokumentasikanhasilperolehansuara

Kegiatanpenghitungandanrekapitulasisuaradilakukanditempatterbuka


Penutup

Penutup

TerimaKasih


  • Login