“The Language Gene”

Jul 25, 2014

40 likes | 111 Views

“The Language Gene”.

Share Presentation

Embed Code

Link

linkage analysis
diagonal line
squares
nature america inc
language impairment
pedigree diagram

barto

Download Presentation

“The Language Gene”

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

“The Language Gene”

Figure 1 Pedigree diagram of family KE. Squares represent males; circles represent females. A diagonal line indicates that the individual is deceased. Family members with speech and language impairment are shaded. Asterisks indicate those individuals who were unavailable for linkage analysis. From Fisher et al. (1998) c° Nature America Inc.

The Gene…

The Gene…. …That changed the world. This will explain:. What is a gene? What is a sex-linked trait? Identify Hemophilia Show the implications of ONE GENE on the ENTIRE COURSE OF 20 th CENTURY HISTORY! . WHAT IS A GENE?. A gene is a portion of… …DNA that codes for… …a protein.

708 views • 30 slides

What is a gene?

What is a gene?. Definitions of the gene. The gene is to genetics what the atom is to chemistry. The gene is the unit of genetic information that controls a specific aspect of the phenotype. The gene is the unit of genetic information that specifies the synthesis of one polypeptide.

557 views • 16 slides

Gene Therapy

Gene Therapy. Correcting defective genes. Definition & history. Normal gene inserted into the genome to replace non-functional gene Trials began in 1990 Cystic fibrosis gene moderately successful. © 2010 Paul Billiet ODWS. Vectors. Viruses eg retro viruses, adenoviruses (commonly used)

252 views • 7 slides

Gene Regulation

Measured by gene expression microarrays. Gene Regulation. [Segal et al.]. System Biology Gene expression: two-phase process Gene is transcribed into mRNA mRNA is translated Protein Genes that are similar expressed are often coregulated and involved in the same cellular processes

509 views • 16 slides

Lecture 4 Microarray & Analysis

Lecture 4 Microarray & Analysis. Alizadeh et al. Nature 403 (2000) 503-511. Microarray revolutionized biology and medicine research. One gene at a time before, now tens of thousands simultaneously - PROTEOMICS Gene expression Gene disease relation Gene-gene interaction

704 views • 32 slides

Gene Expression

Gene Expression. Gene expression?. Biological processes, such as transcription, and in case of proteins, also translation, that yield a gene product. A gene is expressed when its biological product is present and active. Gene expression is regulated at multiple levels.

612 views • 32 slides

GENE MUTATIONS

GENE MUTATIONS. Recall that with a GENE mutation, only one gene on the chromosome is affected. However, many genes are crucial for producing key enzymes and for controlling key cellular processes. WARNING !!!.

623 views • 13 slides

Gene co-option

Gene co-option. the process by which a trait/gene changes function; the gene has been co-opted to do a new job. Gene Co-option. Inheritance of Acquired Characteristics. Epigenetics turns on/off genes. http://cnx.org/content/m26565/latest/graphics35.jpg.

543 views • 19 slides

Gene Expression

Gene Expression. Breaking Down the Definitions--Honors. Gene expression Genome Structural gene Operator Operon Lac operon Repressor protein Regulator gene Inducer Euchromatin Intron Exon Pre-mRNA Transcription factor Enhancer Cell differentiation Homeotic gene Homeobox

399 views • 22 slides

Gene Mutations

Gene Mutations. Sickle Shaped Red Blood Cells. What is a gene mutation?. Mutations are changes in genetic material – changes in DNA code – thus a change in a gene(s) In gene mutations, the DNA code will have a base (or more) missing, added, or exchanged in a codon.

475 views • 24 slides

FROM GENE TO DNA TECHNOLOGY

FROM GENE TO DNA TECHNOLOGY. Case Study: Familial HYPERCHOLESTEROLEMIA. RFLP gene mapping cDNA PCR in-situ hybridization gene cloning “knock-out” genes gene therapy. References: The information about “FH” on these slides is excerpted from Online Mendelian Inheritance in Man

845 views • 47 slides

Chapter 1 GENE

Chapter 1 GENE. PART IV CLUSTERS AND REPEATS. Introduction. Key Terms A gene family consists of a set of genes whose exons are related; the members were derived by duplication and variation from some ancestral gene.

650 views • 41 slides

Epistasis

Epistasis. Basic : 1 gene influences the expression of another gene . ( text pg . 617) Science : A gene at one locus (location on a chromosome) alters the phenotype of another gene. An example of Polygenic Traits 2 (or more) genes that influence the same trait. Example:.

559 views • 6 slides

Identifying and estimating gene-gene and gene-environment interactions

Identifying and estimating gene-gene and gene-environment interactions. Christopher Amos 1,2 and Carol Etzel 1 Departments of Epidemiology and Bioinformatics and Computational Genetics U.T. M.D. Anderson Cancer Center, Houston, TX. Overview of talk. Description of terminology

1.07k views • 82 slides

Detecting Gene-Environment and Gene-Gene Interactions through Endophenotypes

Detecting Gene-Environment and Gene-Gene Interactions through Endophenotypes. Guan-Hua Huang and Shih-Kai Chu National Chiao Tung University TAIWAN.

499 views • 20 slides

RNA – A New Role

RNA – A New Role. Amy Anderson. On You!. Off You!. Introduction – How’d they do that?. 40+ years, still no complete answer…. Gene. Gene. Gene. Gene. How does gene expression get turned on and off?. Anabaena. Heterocysts. How do the cells differentiate?.

326 views • 19 slides

DNA -> RNA -> Proteins

DNA -> RNA -> Proteins. The basic language of all living things. A Gene. A gene is a section of DNA that codes for a specific protein Only a very small percentage of our DNA (perhaps 1%) actually does this. RNA - ribonucleic acid. RNA is short compared to DNA

203 views • 11 slides

Gene Prediction

Gene Prediction. Chengwei Luo, Amanda McCook, Nadeem Bulsara, Phillip Lee, Neha Gupta, and Divya Anjan Kumar. Gene Prediction. Introduction Protein-coding gene prediction RNA gene prediction Modification and finishing Project schema. Gene Prediction. Introduction

1.07k views • 70 slides

Fine Mapping of Complex Traits in Yeast: Mapping Meiotic Recombination across the Genome

Fine Mapping of Complex Traits in Yeast: Mapping Meiotic Recombination across the Genome. Wolfgang Huber EMBL - EBI. Proper chromosome segregation. Increase of genetic diversity. Gene A. Gene B. Gene C. Gene A. Gene b. Gene c. Gene a. Gene b. Gene c. Gene a. Gene B. Gene C.

775 views • 51 slides

From Gene to Protein

From Gene to Protein. Chapter 17. What Is a Gene?. The idea of the gene has evolved through the history of genetics We have considered a gene as A discrete unit of inheritance A region of specific nucleotide sequence in a chromosome

888 views • 65 slides

Annotating a Gene Do I Have the Whole Gene?

Annotating a Gene Do I Have the Whole Gene?. Planctomyces limnophilus imidazole glycerol phosphate synthase subunit hisF VKGVNFLNLQDAGDPVEVAARYERDGADELVFLDITASHEERGIIHDVVR RTSEVCFMPLTVGGGIRNLDDIRTLLQAGCDKVSINSAAVKDPEFVRAAA LKFGKQCIVVNIDPRRVTQPDGSVKWEVHINGGRKPTGLEAVSWAKEVER

355 views • 27 slides

More Related

“The Language Gene”

“The Language Gene”

Presentation Transcript

The Gene…

What is a gene?

Gene Therapy

Gene Regulation

Lecture 4 Microarray &amp; Analysis

Gene Expression

GENE MUTATIONS

Gene co-option

Gene Expression

Gene Mutations

FROM GENE TO DNA TECHNOLOGY

Chapter 1 GENE

Epistasis

Identifying and estimating gene-gene and gene-environment interactions

Detecting Gene-Environment and Gene-Gene Interactions through Endophenotypes

RNA – A New Role

DNA -&gt; RNA -&gt; Proteins

Gene Prediction

Fine Mapping of Complex Traits in Yeast: Mapping Meiotic Recombination across the Genome

From Gene to Protein

Annotating a Gene Do I Have the Whole Gene?

Lecture 4 Microarray & Analysis

DNA -> RNA -> Proteins