This presentation is the property of its rightful owner.
Sponsored Links
1 / 22

FEED ADDITIVES PowerPoint PPT Presentation

  • Uploaded on
  • Presentation posted in: General


Download Presentation


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


Departemen Peternakan Fak.Kedokteran Hewan UNAIR






Departemen Peternakan Fak.Kedokteran Hewan UNAIR




Suatubahanataukombinasibeberapabahan (biasanyakuantitasnyakecil) yang ditambahkan/dicampurkankedalamcampuranpakandasaruntukmemenuhikebutuhankhusus


  • Aman

  • Pemberiandalamjumlahtertentu

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

  • Feed additive dibagi 4 kategori:

  • a. Suplemen

    Termasukdalamkategoriini: vitamin danprovitamin, asam amino, trace elemen, NPN

    b. BahanPembantu:

  • Bahaniniessensialuntukternak

  • Untukmeningkatkankualitasdanpenggunaanbahanpakan meningkatkanproduksiternak

  • Antioksidan, enzim, probiotik, flavor, perekat pellet, pewarnadanpigmen

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

c. PerbaikanPencernaan

  • Preparatpemacupertumbuhan

  • Perbaikankonversipakan

  • Mengurangipengeluarannutriendalamekskreta

    d. BahanPencegahPenyakit

  • Mencegahhewandariseranganpenyakit yang disebabkanolehparasit internal

  • Padaunggasbiasanyaberupakoksidiostat

Departemen Peternakan Fak.Kedokteran Hewan UNAIR


  • Meningkatkanmetabolismetubuh menghasilkanpertumbuhan yang lebihbaik

  • Meningkatkankualitaspakan

  • Meningkatkanhasilproduksiternak


  • Pengikat Pellet

  • Bentonit

  • nilaigizikurang

  • Penggunaannya:

  • « 2,5% total ransum tidakmenimbulkankerugian


Departemen Peternakan Fak.Kedokteran Hewan UNAIR

2. ZatPemberibauharum

  • Tetes

  • meningkatkanpalatabilitasmeningkatkankonsumsi

  • Penggunaannya

  • « 5% total ransum untukunggas

    < 40% total ransum untukruminansia

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

3. Mineral Zeolit « 4% total ransum

  • Merupakanbahantambang yang digunakanuntukmenambah mineral tertentu menjaga balance nutrient suaturansum

  • Dapatmengurangiamoniadalamkotoran

  • Dalamprosespencernaan non ruminansiaberperanmemperlambatlajupakan  memberipeluang yang besaruntukpenyerapanzat-zatnutrien

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

4. Antioksidan

  • MencegahKetengikanoksidatifdarilemakjenuhdalamransumdisebabkan kerusakan vitamin E, A & D  nilaibiologisdanenergiransummenurun

  • kerusakan

  • Perlupenambahandalamransum

  • Ethoxyquin

  • Vitamin E

  • BHT (Butylatedhydroxytoluen)

Kerusakan vitamin E, A & D


Departemen Peternakan Fak.Kedokteran Hewan UNAIR

5. Antibiotika


  • Meningkatkan penyerapan pakan

  • Meningkatkan daya cerna pakan

  • Meningkatkan efisiensi pakan

  • Meningkatkan pertumbuhan

  • Pencegahan penyakit  meningkatkan produksi dan keuntungan

  • Preparat yang sering digunakan: basitrasin, virginiamisin, spiramisin

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

6. Probiotik

  • Merupakankolonibakteri yang diberikanuntukternaktertentudengantujuantertentu

  • Tujuanuntukmeningkatkandayacerna, efisiensipakan, merangsangsintesis protein & mencernaseratkasar memacupertumbuhan/produksiternak

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

7. ObatTradisional:

  • DaunBeluntas

  • Mengandungstigmasterolsebagaiantibakteridanflavanoidberfungsisebagai anti virus

  • Mengandungasam amino essensial, lemak, karbohidrat, Ca, P, Fe, Vitamin A & C

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

  • Penambahanbeluntasdapatmengurangimikroorganismepatogendalamusushalus

  • Penambahandaunbeluntas 6% padaayampedagingdapatmeningkatkankecernaanbahankering (BK) danbahanorganik (BO)

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

b. Temulawak

- Pemberian± 2,5 %

  • Mengandungkurkumin (1,4 – 4%) danminyakatsiri (7,3- 29,5%)

  • Mempercepatpengosonganisilambung nafsumakanmeningkat

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

c. Kunyit (Curcuma domestica.val)

  • Untukmeningkatkanproduksi & kualitastelur

  • Dapatdigunakandalamkeadaansegar & hasilperasannyadicampurpakan

Departemen Peternakan Fak.Kedokteran Hewan UNAIR


  • Minyakatsiri anti bakteriStap, Strep, Pseudomonas aerogenosa

  • Kurkumin anti bakteri

  • Desmetoksirkurkumin

  • Bisdesmetoksirkurkumin

  • Zatpahit

  • Lemak

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

Warnakuningtelurberubah-ubah/sesuaidenganpakan yang diberikan & sifatkhasindividuayam


- Pakan yang mengandung 46,7% jagungkuningwarnakuningtelurlebihgelapdaripadapakan yang mengandung 23,3% jagungkuning

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

  • Penambahan 1% tepungkunyitdalampakan: meningkatkanproduksitelur

  • Penambahan 2% tepungkunyitdalampakan: meningkatkanwarnakuningtelur mempunyaipotensisepertihijauan  klorofil & xantofil

  • Pemberianberlebihan: warnaputihtelurkekuningan & ekskretaberbaukunyit

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

8. DaunPepaya (Carica papaya)


  • enzimpapain proteolitik

  • Alkaloid

  • Karpaina

  • Glikosid

  • Saponin

  • Sakarosa

  • Dextrosa

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

Daunpepayamengandung vitamin A yang cukuptinggi, berfungsiuntukmeningkatkanwarnakuningtelur, warnakuningpadalemakdankulitunggas

Kandungan vitamin A: 18.250 IU ~ 10,95 mg β karoten yang berfungsisebagaiprovitamin A

Penambahansampai 2% tepungdaunpepayadapatmeningkatkanwarnakuningtelur

Departemen Peternakan Fak.Kedokteran Hewan UNAIR



Departemen Peternakan Fak.Kedokteran Hewan UNAIR

Departemen Peternakan Fak.Kedokteran Hewan UNAIR

  • Login