Combining genes in phylogeny
1 / 47

Thank You - PowerPoint PPT Presentation

  • Updated On :

Combining genes in phylogeny And How to test phylogeny methods …. Tal Pupko Department of Cell Research and Immunology, George S. Wise Faculty of Life Sciences, Tel-Aviv University [email protected] Multiple sequence alignment (vWF). Rat QEPGGLVVPPTDAPVSSTTPYVEDTPEPPLHNFYCSK

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about 'Thank You' - Donna

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
Slide1 l.jpg

Combining genes in phylogeny


How to test phylogeny methods…

Tal Pupko

Department of Cell Research and Immunology, George S. Wise Faculty of Life Sciences, Tel-Aviv University

[email protected]

Slide2 l.jpg

Multiple sequence alignment (vWF)





Slide3 l.jpg

From sequences to a phylogenetic tree






Slide4 l.jpg

Multiplemultiple sequence alignment

























Slide5 l.jpg

Phylogenetic studies are now based

on the analysis of multiple genes

Murphy et al. (2001b)

19 nuclear genes +

3 mitochondrial genes

(16,400 bp)

Slide7 l.jpg

Consensus tree
















A consensus tree summarizes information common to two or more trees.

Slide8 l.jpg

Strict consensus





















Strict consensus

Strict consensus includes only those groups that occur in all the trees being considered.

Slide9 l.jpg

Strict consensus





















Strict consensus

Problem: the split {ab} is found 2 out of 3 times, and this is not shown in the strict consensus.

Slide10 l.jpg

Majority-rule consensus





















Majority-rule consensus

Majority-rule consensus: splits that are found in the majority of the trees are shown.

Slide11 l.jpg

Majority-rule consensus





















Majority-rule consensus




The percentage of the trees supporting each splits are indicated

Slide12 l.jpg

Problem with Majority-rule consensus











Majority-rule consensus=

Strict consensus =






However in both trees if we consider only {b,c,d}, then in both trees b is closer to c than b to d, or c to d.

Slide13 l.jpg

Adams consensus
















Adams consensus=

Adams consensus will give the subtrees that are common to all trees. Adams consensus is useful where there is one or more sequences with unclear positions but there’s a subset of sequences that are common to all trees.

Slide14 l.jpg







A network is sometimes used to represent tree in which recombination occurred.

Slide15 l.jpg

Maximum Likelihood








Slide16 l.jpg

Gene 1 +Gene 2 + Gene 3









e.g., Murphy et al. (2001)

Multiple genes analysis

concatenate analysis



Slide17 l.jpg



















e.g., Murphy et al. (2001)

Multiple genes analysis

concatenate analysis

Gene 1

Gene 2

Gene 3













Slide18 l.jpg

What are branch lengths

Branch lengths correspond to evolutionary distance:

d = AA replacements/site=

[AA replacements/(site*year)]*year= Evolutionary rate * year

Slide19 l.jpg



















e.g., Nikaido et al. (2001)

Multiple genes analysis

separate analysis

Gene 1

Gene 2

Gene 3













Slide20 l.jpg


n= 44 ; g = 22

m = 0



Multiple genes analysis

Number of parameters

Number of species = n

Number of gene = g

Number of parameters in the model = m





Number of




Slide21 l.jpg

Multiple genes analysis

Number of parameters

Both oversimplified model and

over-parameterization may lead to the wrong phylogenetic conclusions

Slide22 l.jpg






















Multiple genes analysis

proportional analysis

Gene 1

Gene 2

Gene 3













Slide23 l.jpg


n= 44

g = 22

m = 0




Multiple genes analysis

Number of parameters

Number of species = n

Number of gene = g

Number of parameters in the model = m







Number of





Slide24 l.jpg

Aims of our study

To compare 3 types of multiple-genes analysis:

Concatenate analysis

Separate analysis

Proportional analysis

3 protein datasets:

Mitochondrial data set [56 species, 12 genes]

Nuclear dataset (“short genes”) [46 species, 6 genes]

Nuclear dataset (“long genes”) [28 species, 4 genes]

(Short genes- based on Murphy dataset)

Slide25 l.jpg





Sumatran orangutan

Bornean orangutan

Common gibbon

Barbary ape


White-fronted capuchin

Slow loris

Tree shrew

Japanese pipistrelle

Long-tailed bat

Jamaican fruit-eating bat

Horseshoe bat

Little red flying fox

Ryukyu flying fox






Guinea pig










Blue whale

Fin whale

Sperm whale



Indian rhino

White rhino




Grey seal

Harbor seal



Asiatic shrew


Long-clawed shrew

Small Madagascar hedgehog










Comparing topologies

Morphological topology

(Based on Mc Kenna and Bell, 1997)



Slide26 l.jpg





Indian rhino

White rhino

Grey seal

Harbor seal




Blue whale

Fin whale

Sperm whale







Little red flying fox

Ryukyu flying fox


Horseshoe bat

Japanese pipistrelle

Long-tailed bat


Jamaican fruit-eating bat

Asiatic shrew

Long-clawed shrew


Small Madagascar hedgehog







+ Scandentia


Tree shrew





Sumatran orangutan


Bornean orangutan

Common gibbon

Barbary ape


White-fronted capuchin

Rodentia 1

Slow loris




Rodentia 2

Guinea pig











Aims of our study

Mitochondrial topology

Slide27 l.jpg


Round Eared Bat


Flying Fox
























Flying Lemur

Tree Shrew













Elephant Shrew



Aims of our study

Nuclear topology

(Madsenl tree)

Slide28 l.jpg

Comparing different models using


A model which minimizes the AIC is considered to be the most appropriate model.

Slide29 l.jpg

Results: the best multiple gene analysis

The proportional analysis is the best for the mitochondrial dataset



















(Mitochondrial tree, N-Gamma rate model)

Slide30 l.jpg

Results: the best multiple gene method

The Proportional analysis is the best for the Nuclear dataset (“Short genes”)



















(Murphy dataset, Madsenl tree, N-Gamma rate model)

Slide31 l.jpg

Results: the best multiple gene method

The Separate analysis is the best for the Nuclear dataset (“Long genes”)



















(Madsen dataset, Murphyl tree, N-Gamma rate model)

Slide32 l.jpg

Conclusion: the best multiple gene method

1- The concatenate model is always the worst way to analyze multiple genes.

2- Selecting between the separate analysis or the proportional analysis depends on the data considered:

The proportional model is more adapted for short genes, the separate model for longer sequences

Slide33 l.jpg

Results: mammalian phylogeny

  • The morphological tree is always rejected

  • P(K-H test) < 0.05

  • whatever the model used

  • whatever the dataset

Slide34 l.jpg

Results: mammalian phylogeny

  • The mitochondrial tree is the best tree for the mitochondrial dataset. But we cannot reject the nuclear tree.

  • The nuclear tree is the best for the nuclear datasets, and we can reject the mitochondrial tree.

Conclusion (Topology): It seems that the nuclear tree is the best tree among the 3 alternative trees.

Slide35 l.jpg

Modelisation of site rate variation

The gamma distribution:

Homogenous model:

F(t+x) = F(t).P(x)

Site proportions f(r)

Gamma model:

F(t+x) =

S (1/n).F(t).P(x.Rn)



Substitution rates (R)

Slide36 l.jpg

Likelihoods with rate variation















Slide37 l.jpg

Results: the best site-rate variation model

Mitochondrial data set

(Mitochondrial tree, proportional analysis)



















Slide38 l.jpg


the best site-rate variation model

The N-Gamma model is always the best site-rate variation model.

Slide39 l.jpg

Combining Multiple Genes


Dorothee Huchon (Florida State University)

Masami Hasegawa (Institute of Statistical Mathematics)

Norihiri Okada (Tokyo Institute of Technology)

Ying Cao (ISM).

Slide41 l.jpg

Known phylogenies

Best way to test different methods of phylogenetic reconstruction is on trees that are known to be true from other resources…

Problem: known phylogenies are very rare.

Known phylogeny: laboratory animals, crop plants (and even those are often suspect). Also their evolutionary rate is very small…

Slide42 l.jpg

Known phylogenies

David Hillis and colleagues have created “experimental” phylogenies in the lab.

Slide43 l.jpg

Known phylogenies

They have used bacteriophage T7 and subdivided cultures of it, in the present of a mutagen. They then sequenced a marker gene from the final cultures and gave the sequences as input to few phylogenetic methods. The output of the tree building methods was compared to the true tree.

Slide44 l.jpg

Known phylogenies

In fact, they used restriction sites method to infer the phylogeny, using MP, NJ, UPGMA and others.

All methods reconstructed the true tree.

Slide45 l.jpg

Known phylogenies

They also compared outputs of ancestral sequence reconstruction, using MP.

97.3% of the ancestral states were correctly reconstructed.


Slide46 l.jpg

Known phylogenies

Criticism: (1) The true tree was very easy to infer, because it was well balances, and all nodes are accompanied by numerous changes.

(2) The mutations by a single mutagen do not reflect reality.
